Product List
(Total 998 Products )
Research Chemical Peptide Powder Ghrp-6 for Weight Loss
CAS: 158861-67-7
Formula:C45H55N9O6
Peptides Sequence:D-Ala-D-B-Nal-Ala-Trp-D-Phe-Lys-NH2
GHRP-2 is a growth horm ...
CAS: 158861-67-7
Formula:C45H55N9O6
Peptides Sequence:D-Ala-D-B-Nal-Ala-Trp-D-Phe-Lys-NH2
GHRP-2 is a growth horm ...
FOB Price: US $1 / Piece
Min. Order: 20 Pieces
Supply purity peptides Ghrp 2 for Muscle Gain
CAS: 158861-67-7
Formula: C45H55N9O6
Peptides Sequence: D-Ala-D-B-Nal-Ala-Trp-D-Phe-Lys-NH2
GHRP-2 is a growth horm releasing ...
CAS: 158861-67-7
Formula: C45H55N9O6
Peptides Sequence: D-Ala-D-B-Nal-Ala-Trp-D-Phe-Lys-NH2
GHRP-2 is a growth horm releasing ...
FOB Price: US $1 / Piece
Min. Order: 20 Pieces
Bodybuilding Peptide Fragment 176-191
Formula: C78H125N23O23S2
Sequence: H-Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe-OH
Frag 176-191 is a modified amino ...
Formula: C78H125N23O23S2
Sequence: H-Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe-OH
Frag 176-191 is a modified amino ...
FOB Price: US $2-9 / Piece
Min. Order: 20 Pieces
99% Melanotan II, Melanotan 2 for Skin Tanning
Basic Details:
Product Name: Melanotan II
Other Name: Melanotan 2, MT-2
CAS: 121062-08-6
MF: C50H69N15O9
MW: 1024.18 ...
Basic Details:
Product Name: Melanotan II
Other Name: Melanotan 2, MT-2
CAS: 121062-08-6
MF: C50H69N15O9
MW: 1024.18 ...
FOB Price: US $2-10 / Piece
Min. Order: 10 Pieces
99% Melanotan II (MT 2, MT II) in UK/Sweden
Basic Details:
Product Name: Melanotan II
Other Name: Melanotan 2, MT-2
CAS: 121062-08-6
MF: C50H69N15O9
MW: 1024.18
Purity ...
Basic Details:
Product Name: Melanotan II
Other Name: Melanotan 2, MT-2
CAS: 121062-08-6
MF: C50H69N15O9
MW: 1024.18
Purity ...
FOB Price: US $2-10 / Piece
Min. Order: 10 Pieces
Raw Peptide Powder Melanotan 2 for Tanning
Product Name: Melanotan II
Other Name: Melanotan 2, MT-2
CAS: 121062-08-6
MF: C50H69N15O9
MW: 1024.18
Purity (by HPLC): 99% ...
Product Name: Melanotan II
Other Name: Melanotan 2, MT-2
CAS: 121062-08-6
MF: C50H69N15O9
MW: 1024.18
Purity (by HPLC): 99% ...
FOB Price: US $2-10 / Piece
Min. Order: 10 Pieces
Melanotan-2 for Summer Tanning of Peptides in uk
Basic Details:
Product Name: Melanotan II
Other Name: Melanotan 2, MT-2
CAS: 121062-08-6
MF: C50H69N15O9
MW: 1024.18 ...
Basic Details:
Product Name: Melanotan II
Other Name: Melanotan 2, MT-2
CAS: 121062-08-6
MF: C50H69N15O9
MW: 1024.18 ...
FOB Price: US $2-10 / Piece
Min. Order: 10 Pieces
Hot Peptide Mt 2/Melanotan 2/Mt II for Tan Skin
Basic Details:
Product Name: Melanotan II
Other Name: Melanotan 2, MT-2
CAS: 121062-08-6
MF: C50H69N15O9
MW: 1024.18 ...
Basic Details:
Product Name: Melanotan II
Other Name: Melanotan 2, MT-2
CAS: 121062-08-6
MF: C50H69N15O9
MW: 1024.18 ...
FOB Price: US $2-10 / Piece
Min. Order: 10 Pieces
Polypeptides Melanotan 2 / Mt2 / Melanotan II in uk
Basic Details:
Product Name: Melanotan II
Other Name: Melanotan 2, MT-2
CAS: 121062-08-6
MF: C50H69N15O9
MW: 1024.18 ...
Basic Details:
Product Name: Melanotan II
Other Name: Melanotan 2, MT-2
CAS: 121062-08-6
MF: C50H69N15O9
MW: 1024.18 ...
FOB Price: US $2-10 / Piece
Min. Order: 10 Pieces
Peptide Powder Sermorelin for Muscle Bodybuilding
Cas No.: 86168-78-7
Molecular Formula: C149H246N44O42S
Sequence: ...
Cas No.: 86168-78-7
Molecular Formula: C149H246N44O42S
Sequence: ...
FOB Price: US $4-10 / Piece
Min. Order: 5 Pieces
Peptides Sermorelin in uk
Cas No.: 86168-78-7
Molecular Formula: C149H246N44O42S
Sequence: ...
Cas No.: 86168-78-7
Molecular Formula: C149H246N44O42S
Sequence: ...
FOB Price: US $4-10 / Piece
Min. Order: 5 Pieces
Polypeptide Fragment 176-191 2mgVial in EU
Fragment 176-191 Picture
Hot selling peptides from danney
We are peptides manufacturer in China. What′s more, we have ...
Fragment 176-191 Picture
Hot selling peptides from danney
We are peptides manufacturer in China. What′s more, we have ...
FOB Price: US $1-7 / Piece
Min. Order: 10 Pieces
Wholesale 99% purity Peptides Peg-Mgf 2 Mg/Vial for Bodybuliding
Formula: C121H200N42O39
Molecular weight: 2888.16
Sequence: ...
Formula: C121H200N42O39
Molecular weight: 2888.16
Sequence: ...
FOB Price: US $2-6 / Piece
Min. Order: 10 Pieces
High purity Sermorelin Acetate from ukwarehouse
Cas No.: 86168-78-7
Molecular Formula: C149H246N44O42S
Sequence: ...
Cas No.: 86168-78-7
Molecular Formula: C149H246N44O42S
Sequence: ...
FOB Price: US $4-10 / Piece
Min. Order: 5 Pieces
Melanotan, Mt II, Melanotan 2, Mt2 CAS 121062-08-6
Formula: C50H69N15O9
Sequence: Ac-Nle-Asp-His-D-Phe-Arg-Trp-Lys-NH2(cyclic 2-7)
Hot-selling Peptides list from danney
Lab ...
Formula: C50H69N15O9
Sequence: Ac-Nle-Asp-His-D-Phe-Arg-Trp-Lys-NH2(cyclic 2-7)
Hot-selling Peptides list from danney
Lab ...
FOB Price: US $4-10 / Piece
Min. Order: 5 Pieces
Best Selling Mt2 Mt-2 Melanotan II Mt2
Formula: C50H69N15O9
Sequence: Ac-Nle-Asp-His-D-Phe-Arg-Trp-Lys-NH2(cyclic 2-7)
Hot-selling Peptides list from danney
Lab information: ...
Formula: C50H69N15O9
Sequence: Ac-Nle-Asp-His-D-Phe-Arg-Trp-Lys-NH2(cyclic 2-7)
Hot-selling Peptides list from danney
Lab information: ...
FOB Price: US $4-10 / Piece
Min. Order: 5 Pieces
99.9% Purity Polypeptide Melanotan2 in uk
Basic Details:
Product Name: Melanotan II
Other Name: Melanotan 2, MT-2
CAS: 121062-08-6
MF: C50H69N15O9
MW: 1024.18
Purity ...
Basic Details:
Product Name: Melanotan II
Other Name: Melanotan 2, MT-2
CAS: 121062-08-6
MF: C50H69N15O9
MW: 1024.18
Purity ...
FOB Price: US $2-10 / Piece
Min. Order: 10 Pieces
Lab Supply Melanotan 2 for skin tainning
Basic Details:
Product Name: Melanotan II
Other Name: Melanotan 2, MT-2
CAS: 121062-08-6
MF: C50H69N15O9
MW: 1024.18
Purity ...
Basic Details:
Product Name: Melanotan II
Other Name: Melanotan 2, MT-2
CAS: 121062-08-6
MF: C50H69N15O9
MW: 1024.18
Purity ...
FOB Price: US $2-10 / Piece
Min. Order: 10 Pieces
Melanotan 2 Melanotan II Mt II for Skin Tanning
Basic Details:
Product Name: Melanotan II
Other Name: Melanotan 2, MT-2
CAS: 121062-08-6
MF: C50H69N15O9
MW: 1024.18 ...
Basic Details:
Product Name: Melanotan II
Other Name: Melanotan 2, MT-2
CAS: 121062-08-6
MF: C50H69N15O9
MW: 1024.18 ...
FOB Price: US $2-10 / Piece
Min. Order: 10 Pieces
Melanotan 2 Tanning Peptide Melanotan II Mt II In UK
Basic Details:
Product Name: Melanotan II
Other Name: Melanotan 2, MT-2
CAS: 121062-08-6
MF: C50H69N15O9
MW: 1024.18 ...
Basic Details:
Product Name: Melanotan II
Other Name: Melanotan 2, MT-2
CAS: 121062-08-6
MF: C50H69N15O9
MW: 1024.18 ...
FOB Price: US $2-10 / Piece
Min. Order: 10 Pieces
Top Quality Melanotan 2 10mg/Vial in uk
Basic Details:
Product Name: Melanotan II
Other Name: Melanotan 2, MT-2
CAS: 121062-08-6
MF: C50H69N15O9
MW: 1024.18
Purity ...
Basic Details:
Product Name: Melanotan II
Other Name: Melanotan 2, MT-2
CAS: 121062-08-6
MF: C50H69N15O9
MW: 1024.18
Purity ...
FOB Price: US $2-10 / Piece
Min. Order: 10 Pieces
Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Molar Mass: 7,372 Da
Compound: Thr-Leu-Cys-Gly-Ala.
Purity: 99.21%
DES Dose
can be dosed ...
FOB Price: US $1-10 / Piece
Min. Order: 5 Pieces
99.9% Purity Polypeptide Melanotan2 in uk
Basic Details:
Product Name: Melanotan II
Other Name: Melanotan 2, MT-2
CAS: 121062-08-6
MF: C50H69N15O9
MW: 1024.18
Purity (by ...
Basic Details:
Product Name: Melanotan II
Other Name: Melanotan 2, MT-2
CAS: 121062-08-6
MF: C50H69N15O9
MW: 1024.18
Purity (by ...
FOB Price: US $2-10 / Piece
Min. Order: 10 Pieces
Melanotan 2, Melanotan, Mt II, Mt2 for Tanning Injections 10mg
Formula: C50H69N15O9
Sequence: Ac-Nle-Asp-His-D-Phe-Arg-Trp-Lys-NH2(cyclic 2-7)
Melanotan 2 (MT-2) is a man-made ...
Formula: C50H69N15O9
Sequence: Ac-Nle-Asp-His-D-Phe-Arg-Trp-Lys-NH2(cyclic 2-7)
Melanotan 2 (MT-2) is a man-made ...
FOB Price: US $4-10 / Piece
Min. Order: 5 Pieces